Chicken Shawarma Crispy Rice Salad  recipe
1/3
3.8(220 reviews)
RecipeSaladsMedium

Chicken Shawarma Crispy Rice Salad

Discover how to make Chicken Shawarma Crispy Rice Salad . A delicious recipe with detailed instructions.

25

Prep Time

25

Cook Time

80

Total Time

4

Servings

⏱ Cooking Timer

25:00

Minutes : Seconds

minutes

Why You'll Love This Recipe

Discover how to make Chicken Shawarma Crispy Rice Salad . A delicious recipe with detailed instructions.

Chicken Shawarma Crispy Rice Salad  - Step 2

Ingredients

Instructions

1

Step 1

1. In a bowl, combine chicken strips with 2 tablespoons olive oil, cumin, paprika, garlic powder, turmeric, salt, and pepper. Mix well and marinate for 30 minutes at room temperature or up to 4 hours in the refrigerator.

2

Step 2

2. Preheat your oven to 425°F (220°C) or prepare a grill for medium-high heat.

3

Step 3

3. Arrange marinated chicken on a baking sheet or grill and cook for 15-20 minutes, turning once, until golden brown and cooked through (internal temperature reaches 165°F/74°C). Let rest for 5 minutes.

4

Step 4

4. While chicken cooks, heat 2 tablespoons olive oil in a large skillet over medium-high heat. Add cooled rice in an even layer and press down gently. Cook undisturbed for 5-7 minutes until the bottom becomes crispy and golden brown. Break into pieces and set aside.

5

Step 5

5. In a small bowl, whisk together tahini, lemon juice, minced garlic, 2 tablespoons olive oil, and 2-3 tablespoons water until smooth. Season with salt and pepper.

6

Step 6

6. In a large serving bowl, combine crispy rice, cucumber, tomatoes, red onion, and herbs.

7

Step 7

7. Slice the rested chicken and arrange over the rice salad. Drizzle with tahini dressing and serve immediately.

Chicken Shawarma Crispy Rice Salad  - Step 3

You Must Know

  • For extra crispy rice, spread cooked rice on a baking sheet and refrigerate uncovered for 1-2 hours before crisping
  • Don't overcrowd the pan when crisping rice to ensure maximum crunch
  • Let the chicken rest after cooking to keep it juicy and tender

Chef's Notes

For extra crispy rice, spread cooked rice on a baking sheet and refrigerate uncovered for 1-2 hours before crisping

Don't overcrowd the pan when crisping rice to ensure maximum crunch

Let the chicken rest after cooking to keep it juicy and tender

Serving Suggestions

Serve this salad warm or at room temperature, perfect for lunch or a light dinner. Pair with warm pita bread, hummus, or pickled vegetables for a complete Middle Eastern-inspired meal. Ideal for meal prep as components can be stored separately and assembled when ready to eat.

Nutritional Info (Per Serving)

485

Calories

28g

Protein

38g

Carbs

25g

Fat

Tags

chickenshawarmacrispyricesaladthighsbreaststbsp
Chef Avatar

Lily

Your go-to site for tasty, homemade recipes.

Follow us on social media

More Salads Recipes

Loading...
SALADS

Chicken Shawarma Crispy Rice Salad

Discover how to make Chicken Shawarma Crispy Rice Salad . A delicious recipe with detailed instructions.

Servings:4
Prep:25 min
Cook:25 min

Ingredients (20)

1 lb chicken thighs or breasts, cut into 1-inch strips
2 tablespoons olive oil
2 teaspoons ground cumin
1 teaspoon paprika
1 teaspoon garlic powder
½ teaspoon ground turmeric
½ teaspoon salt
¼ teaspoon black pepper
2 cups cooked rice (preferably basmati or jasmine), cooled and dried
2 tablespoons olive oil (for crisping rice)
1 cucumber, diced
2 tomatoes, chopped
½ red onion, thinly sliced
¼ cup fresh parsley or cilantro, chopped
¼ cup tahini
Juice of 1 lemon
1 garlic clove, minced
2 tablespoons olive oil
2-3 tablespoons water (to thin dressing)
Salt and pepper to taste

Instructions

  1. In a bowl, combine chicken strips with 2 tablespoons olive oil, cumin, paprika, garlic powder, turmeric, salt, and pepper. Mix well and marinate for 30 minutes at room temperature or up to 4 hours in the refrigerator.
  2. Preheat your oven to 425°F (220°C) or prepare a grill for medium-high heat.
  3. Arrange marinated chicken on a baking sheet or grill and cook for 15-20 minutes, turning once, until golden brown and cooked through (internal temperature reaches 165°F/74°C). Let rest for 5 minutes.
  4. While chicken cooks, heat 2 tablespoons olive oil in a large skillet over medium-high heat. Add cooled rice in an even layer and press down gently. Cook undisturbed for 5-7 minutes until the bottom becomes crispy and golden brown. Break into pieces and set aside.
  5. In a small bowl, whisk together tahini, lemon juice, minced garlic, 2 tablespoons olive oil, and 2-3 tablespoons water until smooth. Season with salt and pepper.
  6. In a large serving bowl, combine crispy rice, cucumber, tomatoes, red onion, and herbs.
  7. Slice the rested chicken and arrange over the rice salad. Drizzle with tahini dressing and serve immediately.

More Salads Recipes

Loading...

Community Reviews

What cooks are saying

3.8

220 reviews

Loading reviews…

Share your experience

Leave a review

Help other home cooks decide if this recipe is right for them. Honest feedback is appreciated!